- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Optimal dilution of the YY1 antibody should be determined by the researcher.
Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ were used as the immunogen for the YY1 antibody.
After reconstitution, the YY1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.