- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Yes-associated protein 1, also known as YAP or YAP65, is a potent oncogene, which is amplified in various human cancers. This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. It is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.
Optimal dilution of the YAP1 antibody should be determined by the researcher.
Amino acids ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK from the human protein were used as the immunogen for the YAP1 antibody.
After reconstitution, the YAP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.