- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Vinexin is a protein that in humans is encoded by the SORBS3 gene. It is mapped to 8p21.3. This gene encodes an SH3 domain-containing adaptor protein. The presence of SH3 domains play a role in this protein's ability to bind other cytoplasmic molecules and contribute to cystoskeletal organization, cell adhesion and migration, signaling, and gene expression. Multiple transcript variants encoding different isoforms have been found for this gene.
Optimal dilution of the Vinexin antibody should be determined by the researcher.
Amino acids ASTKIPASQHTQNWSATWTKDSKRRDKRWVKYE from the human protein were used as the immunogen for the Vinexin antibody.
After reconstitution, the Vinexin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.