- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
SET and MYND domain-containing protein 3 is a protein that in humans is encoded by the SMYD3 gene. The International Radiation Hybrid Mapping Consortium mapped the SMYD3 gene to chromosome 1. This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene.
Optimal dilution of the SMYD3 antibody should be determined by the researcher.
Amino acids QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS of human SMYD3 were used as the immunogen for the SMYD3 antibody.
After reconstitution, the SMYD3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.