- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Optimal dilution of the RXFP2 antibody should be determined by the researcher.
Amino acids MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ were used as the immunogen for the RXFP2 antibody.
After reconstitution, the RXFP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.