• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> PTGS2 Antibody / COX2

PTGS2 Antibody / COX2 (R32712)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32712 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) Jurkat, 2) HeLa, 3) HepG2, 4) A549 and 5) U-87 MG cell lysate with PTGS2 antibody at 0.5ug/ml. Predicted molecular weight ~69 kDa.
Western blot testing of human 1) Jurkat, 2) HeLa, 3) HepG2, 4) A549 and 5) U-87 MG cell lysate with PTGS2 antibody at 0.5ug/ml. Predicted molecular weight ~69 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P35354
Applications Western Blot : 0.5-1ug/ml
Limitations This PTGS2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Cyclooxygenase (Cox) is the key enzyme in conversion of arachidonic acid to PGs, and two isoforms, Cox-1 and Cox-2, have been identified. Cox-2 gene encodes an inducible prostaglandin synthase enzyme that is overexpressed in adenocarcinomas and other tumors. Deletion of the murine Cox-2 gene in Min mice reduced the incidence of intestinal tumors, suggesting that it is required for tumorigenesis. This gene is localized to sites associated with retinal blood vessels, and plays an important role in blood vessel formation in the retina. And the glucocorticoid receptor suppression of COX-2 is also crucial for curtailing lethal immune activation, and suggests new therapeutic approaches for regulation of T-cell-mediated inflammatory diseases.

Application Notes

Optimal dilution of the PTGS2 antibody should be determined by the researcher.

Immunogen

Amino acids 365-397 (AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN) from the human protein were used as the immunogen for the PTGS2 antibody.

Storage

After reconstitution, the PTGS2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all PTGS2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.