• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> PSMA3 Antibody / Proteasome 20S alpha 3

PSMA3 Antibody / Proteasome 20S alpha 3 (R32557)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32557 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat testis, 2) mouse lung and 3) human 293T lysate with PSMA3 antibody at 0.5ug/ml. Predicted/observed molecular weight ~28 kDa.
›
Western blot testing of 1) rat testis, 2) mouse lung and 3) human 293T lysate with PSMA3 antibody at 0.5ug/ml. Predicted/observed molecular weight ~28 kDa.
IHC testing of FFPE human intestine cancer tissue with PSMA3 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse brain with PSMA3 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat brain with PSMA3 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human HeLa cells with PSMA3 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PSMA3 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P25788
Localization Cytoplasmic, nuclear
Applications Western blot : 0.5-1ug/ml
Immunohistochemisty (FFPE) : 1-2ug/ml
Flow cytometry : 1-3ug/10^6 cells
Limitations This PSMA3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Proteasome subunit alpha type-3, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the PSMA3 antibody to be titrated for optimal performance.

Immunogen

Amino acids 88-127 (LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS) from the human protein were used as the immunogen for the PSMA3 antibody.

Storage

After reconstitution, the PSMA3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all PSMA3 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.