- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.
Differences in protocols and secondary/substrate sensitivity may require the PSMA2 antibody to be titrated for optimal performance.
Amino acids 82-123 (DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQ) from the human protein were used as the immunogen for the PSMA2 antibody.
After reconstitution, the PSMA2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.