- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Promyelocytic leukemia protein functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms.
Optimal dilution of the PML antibody should be determined by the researcher.
Amino acids 140-177 (LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN) from the mouse protein were used as the immunogen for the PML antibody.
After reconstitution, the PML antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.