• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> OGG1 Antibody

OGG1 Antibody (RQ4046)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4046 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of rat 1) spleen, 2) thymus, 3) liver and 4) testis lysate with OGG1 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.
Western blot testing of rat 1) spleen, 2) thymus, 3) liver and 4) testis lysate with OGG1 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt O15527
Applications Western Blot : 0.5-1ug/ml
Limitations This OGG1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : IHC-P
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human, Mouse
  • Applications : WB, IHC-P, ELISA (peptide)
    Reactivity : Human, Rat
    Pred. Reactivity : Mouse

Description

8-Oxoguanine glycosylase also known as OGG1 is a DNA glycosylase enzyme that, in humans, is encoded by theOGG1 gene. This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization. Many alternative splice variants for this gene have been described, but the full-length nature for every variant has not been determined.

Application Notes

Optimal dilution of the OGG1 antibody should be determined by the researcher.

Immunogen

Amino acids KYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQD from the human protein were used as the immunogen for the OGG1 antibody.

Storage

After reconstitution, the OGG1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all OGG1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.