- Tel: 858.663.9055
- Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [UniProt]
Optimal dilution of the NFIB antibody should be determined by the researcher.
Amino acids ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR were used as the immunogen for the NFIB antibody.
After reconstitution, the NFIB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.