- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. [UniProt]
Optimal dilution of the Kv1.4 antibody should be determined by the researcher.
Amino acids SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK of human Kv1.4 were used as the immunogen for the Kv1.4 antibody.
After reconstitution, the Kv1.4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.