• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Ku70 Antibody / XRCC6

Ku70 Antibody / XRCC6 (R31952)

  Catalog No Formulation Size Price (USD)  
Image R31952 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
IHC staining of FFPE human pancreas ductal adenocarcinoma tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human testicular seminoma tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human colon adenocarcinoma tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lung adenocarcinoma tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human liver cancer tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human glioblastoma tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human bladder cancer tissue with Ku70 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human colon cancer tissue with Ku70 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE human U-2 OS cells with Ku70 antibody (red) and Beta Tubulin mAb (green). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) LNCaP, 2) HeLa, 3) 293T, 4) HepG2, 5) Jurkat, 6) K562, 7) A549 and 8) A431 cell lysate with Ku70 antibody. Predicted molecular weight ~70 kDa.
Flow cytometry testing of fixed and permeabilized human A431 cells with Ku70 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Ku70 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P12956
Localization Nuclear
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Flow cytometry : 1-3ug/million cells
Immunofluorescence : 5ug/ml
Limitations This Ku70 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : IHC-P, WB
    Reactivity : Human
    Rab Mono Image
  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human
  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human
  • Applications : WB, IHC-P, ICC, IF, FACS
    Reactivity : Human
  • Applications : WB, IHC, FACS, ELISA
    Reactivity : Human, Mouse
  • Applications : WB, IHC, FACS, IF, ELISA
    Reactivity : Human
  • Applications : IHC, FACS, IF, WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA (peptide)
    Reactivity : Human

Description

XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.

Application Notes

Optimal dilution of the Ku70 antibody should be determined by the researcher.

Immunogen

Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody.

Storage

After reconstitution, the Ku70 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.