- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.
Optimal dilution of the IKZF1 antibody should be determined by the researcher.
Amino acids 428-459 (LKEEHRAYDLLRAASENSQDALRVVSTSGEQM) from the human protein were used as the immunogen for the IKZF1 antibody.
After reconstitution, the IKZF1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.