• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> IGFBP2 Antibody

IGFBP2 Antibody (R31993)

  Catalog No Formulation Size Price (USD)  
Image R31993 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat brain, 2) rat liver, and 3) human placenta lysate with IGFBP2 antibody. Predicted/observed molecular weight ~35 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P18065
Localization Cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
Limitations This IGFBP2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC, IF, FACS, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Pig
  • Applications : WB, IHC-P, ELISA (capture)
    Reactivity : Human
  • Applications : WB, IHC-P, IF, FACS, ELISA
    Reactivity : Mouse, Rat

Description

The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-translational modifications of IGFBPs, including glycosylation, phosphorylation and proteolysis, have been shown to modify the affinities of the binding proteins to IGF. Human IGFBP-2 cDNA encodes a 328 amino acid (aa) residue precursor protein with a putative 39 aa residue signal peptide that is processed to generate the 289 aa residue mature protein. IGFBP-2 contains an integrin receptor recognition sequence (RGD sequence) but lacks potential N-linked glycosylation sites. During development, IGFBP-2 is expressed in a number of tissues. The highest expression level is found in the central nervous system. In adults, high expression levels are also detected in the central nervous system and in a number of reproductive tissues. IGFBP-2 binds preferentially to IGF II, exhibiting a 2-10 fold higher affinity for IGF II than for IGF I.

Application Notes

Optimal dilution of the IGFBP2 antibody should be determined by the researcher.

Immunogen

Amino acids QQELDQVLERISTMRLPDERGPLEHLYSLH of human IGFBP2 were used as the immunogen for the IGFBP2 antibody.

Storage

After reconstitution, the IGFBP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.