- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is anRNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.
Optimal dilution of the HuD antibody should be determined by the researcher.
Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody.
After reconstitution, the HuD antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.