- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.
Optimal dilution of the GRK3 antibody should be determined by the researcher.
Amino acids ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR of human GRK3/ADRBK2 were used as the immunogen for the GRK3 antibody.
After reconstitution, the GRK3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.