- Tel: 858.663.9055
- Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Protein phosphatase 1 regulatory subunit 15A also known as growth arrest and DNA damage-inducible protein GADD34 is a protein that in humans is encoded by the PPP1R15A gene.
Optimal dilution of the GADD34 antibody should be determined by the researcher.
Amino acids MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLR were used as the immunogen for the GADD34 antibody.
After reconstitution, the GADD34 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.