- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Fos-related antigen 1 (FRA1) is a protein that in humans is encoded by the FOSL1 gene. The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.
Optimal dilution of the FRA1 antibody should be determined by the researcher.
Amino acids QPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPH from the human protein were used as the immunogen for the FRA1 antibody.
After reconstitution, the FRA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.