EWSR1 Antibody | EWS | R32181 NSJ Bioreagents

	Catalog No	Formulation	Size	Price (USD)
	R32181	0.5mg/ml if reconstituted with 0.2ml sterile DI water	100 ug	429
Formulation

›

ICC staining of FFPE human SMMC-7721 cells with EWSR1 antibody at 1ug/ml. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

IHC testing of FFPE human breast cancer tissue with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

IHC testing of FFPE mouse testis with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

IHC testing of FFPE rat testis with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

IHC staining of frozen human placental tissue with EWSR1 antibody at 1ug/ml.

IHC staining of frozen mouse intestinal tissue with EWSR1 antibody at 1ug/ml.

IHC staining of frozen rat intestinal tissue with EWSR1 antibody at 1ug/ml.

Immunofluorescent staining of FFPE human U-2 OS cells with EWSR1 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.

Western blot testing of human 1) HeLa, 2) K562, 3) Jurkat, 4) HL60 and 5) HEK293 cell lysate with EWSR1 antibody. Predicted molecular weight: ~69 kDa, but routinely observed at ~90 kDa.

Flow cytometry testing of human U-2 OS cells with EWSR1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= EWSR1 antibody.

Availability	1-3 business days
Species Reactivity	Human, Mouse, Rat
Format	Antigen affinity purified
Clonality	Polyclonal (rabbit origin)
Isotype	Rabbit IgG
Purity	Antigen affinity
Buffer	Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt	Q01844
Localization	Nuclear
Applications	Western blot : 0.1-0.5ug/ml Immunohistochemistry (FFPE) : 0.5-1ug/ml Immunohistochemistry (Frozen) : 1-2ug/ml Immunocytochemistry (FFPE) : 1-2ug/ml Immunofluorescence (FFPE) : 2-4ug/ml Flow cytometry : 1-3ug/10^6 cells
Limitations	This EWSR1 antibody is available for research use only.
	Review this product on BioCompare and get a $20 Amazon gift card

Description

This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Application Notes

Optimal dilution of the EWSR1 antibody should be determined by the researcher.

Immunogen

Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody.

Storage

After reconstitution, the EWSR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

1. View all EWSR1 antibodies

EWSR1 Antibody / EWS (R32181)

Description

Application Notes

Immunogen

Storage

Related Products

Area of Research

Product Type

Protocols

Contact Us

NSJ Bioreagents