- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene.
Optimal dilution of the ETV4 antibody should be determined by the researcher.
Amino acids MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD of human PEA3/ETV4 were used as the immunogen for the ETV4 antibody.
After reconstitution, the ETV4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.