- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.
Optimal dilution of the ETS1 antibody should be determined by the researcher.
Amino acids 67-98 (KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF) from the human protein were used as the immunogen for the ETS1 antibody.
After reconstitution, the ETS1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.