- Tel: 858.663.9055
- Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 is an enzyme that in humans is encoded by the DHX15 gene. It is mapped to 4p15.2. The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.
Optimal dilution of the DHX15 antibody should be determined by the researcher.
Amino acids DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY from the human protein were used as the immunogen for the DHX15 antibody.
After reconstitution, the DHX15 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.