- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
CRX Antibody (R32644)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32644 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| UniProt | O43186 |
| Applications | Western Blot : 0.5-1ug/ml |
| Limitations | This CRX antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.
Optimal dilution of the CRX antibody should be determined by the researcher.
Amino acids 265-299 (DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL) from the human protein were used as the immunogen for the CRX antibody.
After reconstitution, the CRX antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
