- Tel: 858.663.9055
- Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Cell division protein kinase 6, also called Plstire, is an enzyme that in humans is encoded by the CDK6 gene. The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. Radiation hybrid analysis and inclusion within a mapped clone place the CDK6 gene at 7q21. Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation and promotes G1/S transition. This gene also involved in initiation and maintenance of cell cycle exit during cell differentiation. It prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types. In addition, CDK6 plays a role in promoting the proliferation of beta-cells in pancreatic islets of Langerhans.
Optimal dilution of the Cdk6 antibody should be determined by the researcher.
Amino acids TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN from the human protein were used as the immunogen for the Cdk6 antibody.
Prior to reconstitution, store at 4oC. After reconstitution, the Cdk6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.