• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CDC25C Antibody

CDC25C Antibody (R32057)

  Catalog No Formulation Size Price (USD)  
Image R32057 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) SW620 and 3) MCF7 lysate with CDC25C antibody. Expected molecular weight: ~53/60 kDa (unmodified/phosphorylated).
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P30307
Applications Western blot : 0.1-0.5ug/ml
Limitations This CDC25C antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human, Mouse
  • Applications : WB
    Reactivity : Human, Rat
  • Applications : WB
    Reactivity : Rat

Description

M-phase inducer phosphatase 3is anenzymethat in humans is encoded by the CDC25C gene. This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1) and triggers entry into mitosis. Also, it is thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

Application Notes

Optimal dilution of the CDC25C antibody should be determined by the researcher.

Immunogen

Amino acids MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP of human CDC25C were used as the immunogen for the CDC25C antibody.

Storage

After reconstitution, the CDC25C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.