• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Cd46 Antibody

Cd46 Antibody (R31841)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31841 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) mouse testis and 2) mouse NIH3T3 lysate with Cd46 antibody. Observed molecular weight: 41~70 kDa depending on glycosylation level.
Western blot testing of 1) mouse testis and 2) mouse NIH3T3 lysate with Cd46 antibody. Observed molecular weight: 41~70 kDa depending on glycosylation level.
Availability 1-3 business days
Species Reactivity Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O88174
Applications Western blot : 0.1-0.5ug/ml
Limitations This Cd46 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : Functional studies, FACS, IF
    Reactivity : Human
  • Applications : FACS, IF
    Reactivity : Human
    Citation  Citations(9)
  • Applications : IHC-P, WB
    Reactivity : Human
    Rab Mono Image
  • Applications : WB, IHC-P, FACS
    Reactivity : Human
  • Applications : FACS, IF
    Reactivity : Human
  • Applications : IHC, FACS, IF, WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : IHC-P, FACS, IF, WB
    Reactivity : Human, Mouse, Rat

Description

CD46 complement regulatory protein,also known as CD46 (cluster of differentiation 46) andMembrane Cofactor Protein,is aproteinwhich in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.

Application Notes

Optimal dilution of the Cd46 antibody should be determined by the researcher.

Immunogen

Amino acids ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK of mouse Cd46 were used as the immunogen for the Cd46 antibody.

Storage

After reconstitution, the Cd46 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all CD46 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.