- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1.
Optimal dilution of the ATP11C antibody should be determined by the researcher.
Amino acids QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER from the human protein were used as the immunogen for the ATP11C antibody.
After reconstitution, the ATP11C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.