- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
Differences in protocols and secondary/substrate sensitivity may require the ALDH1B1 antibody to be titrated for optimal performance.
Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein were used as the immunogen for the ALDH1B1 antibody.
After reconstitution, the ALDH1B1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.