• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> AGER Antibody / RAGE

AGER Antibody / RAGE [clone 5C6C1] (RQ7676)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ7676 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
IHC staining of FFPE mouse lung tissue with AGER antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
›
IHC staining of FFPE mouse lung tissue with AGER antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat lung tissue with AGER antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat lung tissue with AGER antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) rat lung and 2) mouse lung tissue lysate with AGER antibody. Predicted molecular weight ~43 kDa.
Flow cytometry testing of human Jurkat cells with AGER antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AGER antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 5C6C1
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q15109
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This AGER antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, IHC-F
    Reactivity : Human, Mouse, Rat
  • Applications : WB, ELISA
    Reactivity : Human, Mouse
  • Applications : WB, IHC, ELISA
    Reactivity : Human, Mouse
  • Applications : WB, IHC, ELISA
    Reactivity : Human
  • Applications : IF, WB, ELISA
    Reactivity : Human
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, Direct ELISA
    Reactivity : Mouse, Rat

Description

The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.

Application Notes

Optimal dilution of the AGER antibody should be determined by the researcher.

Immunogen

Amino acids 91-120 (IQDEGIFRCQAMNRNGKETKSNYRVRVYQI) from the human protein were used as the immunogen for the AGER antibody.

Storage

After reconstitution, the AGER antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all AGER antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.