- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.
Optimal dilution of the ADAM2 antibody should be determined by the researcher.
Amino acids 231-274 (WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK) from the human protein were used as the immunogen for the ADAM2 antibody.
After reconstitution, the ADAM2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.