• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> ABCB10 Antibody

ABCB10 Antibody (R32456)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32456 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat muscle, 2) human COLO320, 3) human 22RV1 and 4) human PANC lysate with ABCB10 antibody at 0.5ug/ml. Expected molecular weight: ~79 kDa (full), ~65 kDa (cleaved mitochondrial targeting sequence (amino acids 1-105)).
Western blot testing of 1) rat muscle, 2) human COLO320, 3) human 22RV1 and 4) human PANC lysate with ABCB10 antibody at 0.5ug/ml. Expected molecular weight: ~79 kDa (full), ~65 kDa (cleaved mitochondrial targeting sequence (amino acids 1-105)).
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q9NRK6
Applications Western blot : 0.5-1ug/ml
Limitations This ABCB10 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC, ELISA
    Reactivity : Human

Description

ABCB10, also known as M-ABC2, is expressed as a 65-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

Application Notes

Optimal dilution of the ABCB10 antibody should be determined by the researcher.

Immunogen

Amino acids 640-678 (QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR) from the human protein were used as the immunogen for the ABCB10 antibody.

Storage

Prior to reconstitution, store at 4oC. After reconstitution, the ABCB10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all ABCB10 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.